| Edit |   |
|---|
| Antigenic Specificity | TXNDC16 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TXNDC16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TXNDC16. This antibody reacts with human. The TXNDC16 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human TXNDC16. Peptide sequence EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV. |
|---|
| Other Names | KIAA1344, thioredoxin domain containing 16, thioredoxin domain-containing protein 16 |
|---|
| Gene, Accession # | TXNDC16, Gene ID: 57544, Accession: NP_065835, SwissProt: NP_065835 |
|---|
| Catalog # | NBP1-91339-20ul |
|---|
| Price | |
|---|
| Order / More Info | TXNDC16 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|