| Edit |   |
| Antigenic Specificity | TXNDC16 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TXNDC16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TXNDC16. This antibody reacts with human. The TXNDC16 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human TXNDC16. Peptide sequence EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV. |
| Other Names | KIAA1344, thioredoxin domain containing 16, thioredoxin domain-containing protein 16 |
| Gene, Accession # | TXNDC16, Gene ID: 57544, Accession: NP_065835, SwissProt: NP_065835 |
| Catalog # | NBP1-91339 |
| Price | |
| Order / More Info | TXNDC16 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |