| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Serpin I2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Serpin I2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Serpin I2. This antibody reacts with human. The Serpin I2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SERPINI2(serpin peptidase inhibitor, clade I (pancpin), member 2) The peptide sequence was selected from the middle region of SERPINI2. Peptide sequence LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF |
|---|
| Other Names | MEPIpancpin, Myoepithelium-derived serine protease inhibitor, Pancpin, Pancreas-specific protein TSA2004, Peptidase inhibitor 14, PI-14, PI14clade I (neuroserpin), member 2, protease inhibitor 14, serine (or cysteine) proteinase inhibitor, clade I (pancpin), member 2, serpin I2, serpin peptidase inhibitor, clade I (pancpin), member 2, SERPIN12 |
|---|
| Gene, Accession # | SERPINI2, Gene ID: 5276, Accession: O75830, SwissProt: O75830 |
|---|
| Catalog # | NBP1-58047-20ul |
|---|
| Price | |
|---|
| Order / More Info | Serpin I2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|