| Edit |   |
|---|
| Antigenic Specificity | GRK7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GRK7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRK7. This antibody reacts with human. The GRK7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GRK7 (G protein-coupled receptor kinase 7) The peptide sequence was selected from the C terminal of GRK7. Peptide sequence FFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL. |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.16, G protein-coupled receptor kinase 7, GPRK7G protein-coupled receptor kinase GRK7 |
|---|
| Gene, Accession # | GRK7, Gene ID: 131890, Accession: Q8WTQ7, SwissProt: Q8WTQ7 |
|---|
| Catalog # | NBP1-68989-20ul |
|---|
| Price | |
|---|
| Order / More Info | GRK7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|