| Edit |   |
| Antigenic Specificity | Rfxap |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-Rfxap Antibody |
| Immunogen | The immunogen for anti-Rfxap antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CTYEGCRETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALGSGGPSA |
| Other Names | regulatory factor X-associated protein |
| Gene, Accession # | Rfxap, Accession: NM_133231 |
| Catalog # | TA329979 |
| Price | |
| Order / More Info | Rfxap Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |