| Edit |   |
| Antigenic Specificity | MBIP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, bovine, porcine, horse, rabbit, guinea pig |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-MBIP Antibody |
| Immunogen | The immunogen for anti-MBIP antibody is: synthetic peptide directed towards the N-terminal region of Human MBIP. Synthetic peptide located within the following region: EVNDKFSIGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRI |
| Other Names | MAP3K12 binding inhibitory protein 1 |
| Gene, Accession # | MBIP1, Accession: NM_016586 |
| Catalog # | TA342913 |
| Price | |
| Order / More Info | MBIP Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |