| Edit |   |
| Antigenic Specificity | MBLAC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, horse, rat, bovine, guinea pig |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-MBLAC1 Antibody |
| Immunogen | The immunogen for Anti-MBLAC1 antibody is: synthetic peptide directed towards the C-terminal region of Human MBLAC1. Synthetic peptide located within the following region: GTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVVADVVVPGHGPP |
| Other Names | metallo-beta-lactamase domain containing 1 |
| Gene, Accession # | MBLC1, Accession: NM_203397 |
| Catalog # | TA337427 |
| Price | |
| Order / More Info | MBLAC1 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |