| Edit |   |
|---|
| Antigenic Specificity | SMIM13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SMIM13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMIM13. This antibody reacts with human. The SMIM13 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SMIM13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT |
|---|
| Other Names | C6orf228, Chromosome 6 Open Reading Frame 228, Small Integral Membrane Protein 13, UPF0766 Protein C6orf228 |
|---|
| Gene, Accession # | SMIM13, Gene ID: 221710, Accession: P0DJ93, SwissProt: P0DJ93 |
|---|
| Catalog # | NBP2-38074 |
|---|
| Price | |
|---|
| Order / More Info | SMIM13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|