| Edit |   |
| Antigenic Specificity | TMEM 138 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM 138 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM 138. This antibody reacts with human. The TMEM 138 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMEM138(transmembrane protein 138) The peptide sequence was selected from the N terminal of TMEM138. Peptide sequence MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVL. |
| Other Names | HSPC196, transmembrane protein 138 |
| Gene, Accession # | TMEM138, Gene ID: 51524, Accession: Q9NPI0, SwissProt: Q9NPI0 |
| Catalog # | NBP1-59523-20ul |
| Price | |
| Order / More Info | TMEM 138 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |