| 产品详情 |
| Edit |   |
| Antigenic Specificity | TMEM1 |
| Clone | 5B4 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM1 Antibody (5B4) from Novus Biologicals is a mouse monoclonal antibody to TMEM1. This antibody reacts with human. The TMEM1 Antibody (5B4) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
| Immunogen | TMEM1 (NP_003265 1162 a.a. - 1257 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS |
| Other Names | EHOC-1FLJ55683, EHOC1GT334, Epilepsy holoprosencephaly candidate 1 protein, epilepsy holoprosencephaly candidate-1 protein, FLJ54223, FLJ54817, Protein GT334, TMEM1MGC126777, trafficking protein particle complex 10, trafficking protein particle complex subunit 10, trafficking protein particle complex subunit 130, Trafficking protein particle complex subunit TMEM1, transmembrane protein 1, Transport protein particle subunit TMEM1, TRAPP 130 kDa subunit, TRAPP subunit TMEM1, TRS130, TRS30 |
| Gene, Accession # | TRAPPC10, Gene ID: 7109, Accession: NP_003265, SwissProt: NP_003265 |
| Catalog # | H00007109-M01 |
| Price | |
| Order / More Info | TMEM1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 22279557 |
| 产品资料 |
|
|