| Edit |   |
|---|
| Antigenic Specificity | TMEM102 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM102 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM102. This antibody reacts with mouse. The TMEM102 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the N terminal of Tmem102. Immunizing peptide sequence KDFVFALLGLVHRQDPRFPPQAELLLLRGGIREGSLDLGHAPLGPYSRGP. |
|---|
| Other Names | CBAP, common beta-chain associated protein, FLJ36878, transmembrane protein 102 |
|---|
| Gene, Accession # | TMEM102, Gene ID: 284114, Accession: Q3UPR7 |
|---|
| Catalog # | NBP1-74231-20ul |
|---|
| Price | |
|---|
| Order / More Info | TMEM102 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|