| Edit |   |
| Antigenic Specificity | TMEM102 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM102 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM102. This antibody reacts with mouse. The TMEM102 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the N terminal of Tmem102. Immunizing peptide sequence KDFVFALLGLVHRQDPRFPPQAELLLLRGGIREGSLDLGHAPLGPYSRGP. |
| Other Names | CBAP, common beta-chain associated protein, FLJ36878, transmembrane protein 102 |
| Gene, Accession # | TMEM102, Gene ID: 284114, Accession: Q3UPR7 |
| Catalog # | NBP1-74231-20ul |
| Price | |
| Order / More Info | TMEM102 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |