| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TMEM103 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM103 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM103. This antibody reacts with human. The TMEM103 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human C3orf75/ELP6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ |
|---|
| Other Names | Angiotonin-transactivated protein 1, ATP1, C3orf75, chromosome 3 open reading frame 75, elongator acetyltransferase complex subunit 6, ELP6, FLJ20211, Protein TMEM103, TMEM103, transmembrane protein 103 |
|---|
| Gene, Accession # | ELP6, Gene ID: 54859 |
|---|
| Catalog # | NBP1-91733 |
|---|
| Price | |
|---|
| Order / More Info | TMEM103 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|