| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | USH1G |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, canine |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID: 30380418). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The USH1G Antibody from Novus Biologicals is a rabbit polyclonal antibody to USH1G. This antibody reacts with human, canine. The USH1G Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human USH1G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER |
|---|
| Other Names | ANKS4A, FLJ33924, SANSSans, Scaffold protein containing ankyrin repeats and SAM domain, Usher syndrome 1G (autosomal recessive), Usher syndrome type-1G protein |
|---|
| Gene, Accession # | USH1G, Gene ID: 124590, Accession: Q495M9, SwissProt: Q495M9 |
|---|
| Catalog # | NBP1-89076 |
|---|
| Price | |
|---|
| Order / More Info | USH1G Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30380418 |
|---|
| 产品资料 |
|
|