| Edit |   |
|---|
| Antigenic Specificity | USMG5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The USMG5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to USMG5. This antibody reacts with human. The USMG5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human USMG5. Peptide sequence MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSK. |
|---|
| Other Names | up-regulated during skeletal muscle growth 5 homolog (mouse) |
|---|
| Gene, Accession # | USMG5, Gene ID: 84833, Accession: NP_116136, SwissProt: NP_116136 |
|---|
| Catalog # | NBP1-91361 |
|---|
| Price | |
|---|
| Order / More Info | USMG5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|