| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | USP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The USP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to USP1. This antibody reacts with human. The USP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human USP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGKITTNQGVKGQSKENECDP |
|---|
| Other Names | Deubiquitinating enzyme 1, EC 3.1.2.15, EC 3.4.19.12, hUBP, ubiquitin carboxyl terminal hydrolase 1, ubiquitin carboxyl-terminal hydrolase 1, ubiquitin specific peptidase 1, ubiquitin specific processing protease 1, ubiquitin specific protease 1, ubiquitin thioesterase 1, Ubiquitin thiolesterase 1, Ubiquitin-specific-processing protease 1, UBP |
|---|
| Gene, Accession # | USP1, Gene ID: 7398 |
|---|
| Catalog # | NBP1-85950 |
|---|
| Price | |
|---|
| Order / More Info | USP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|
| 产品资料 |
|
|