| Edit |   |
| Antigenic Specificity | Rgs18 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal anti-Rgs18 antibody |
| Immunogen | The immunogen for anti-Rgs18 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AKEKRNRLSLLLQRPDFHGETQASRSALLAKETRVSPEEAVKWAESFDKL |
| Other Names | RGS13, regulator of G-protein signaling 18 |
| Gene, Accession # | Rgs18, Accession: NM_022881 |
| Catalog # | TA329546 |
| Price | |
| Order / More Info | Rgs18 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |