| Edit |   |
|---|
| Antigenic Specificity | NOXRED1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NOXRED1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NOXRED1. This antibody reacts with human. The NOXRED1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NOXRED1 The peptide sequence was selected from the middle region of NOXRED1. Peptide sequence KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG. |
|---|
| Other Names | C14orf148, NADP-dependent oxidoreductase domain containing 1 |
|---|
| Gene, Accession # | NOXRED1, Gene ID: 122945 |
|---|
| Catalog # | NBP1-70434-20ul |
|---|
| Price | |
|---|
| Order / More Info | NOXRED1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|