| 产品详情 |
| Edit |   |
| Antigenic Specificity | N-PAC |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The N-PAC Antibody from Novus Biologicals is a rabbit polyclonal antibody to N-PAC. This antibody reacts with human. The N-PAC Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human N-PAC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSD |
| Other Names | BM045, Cytokine-like nuclear factor N-PAC, Glyoxylate reductase 1 homolog, glyoxylate reductase 1 homolog (Arabidopsis), HIBDLnuclear protein 60 kDa, NP603-hydroxyisobutyrate dehydrogenase-like protein, N-PAC, nuclear protein 60kDa, Nuclear protein NP60, Nuclear protein of 60 kDa, putative oxidoreductase GLYR1 |
| Gene, Accession # | GLYR1, Gene ID: 84656, Accession: Q49A26, SwissProt: Q49A26 |
| Catalog # | NBP2-38576 |
| Price | |
| Order / More Info | N-PAC Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|