| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDC2L5 |
|---|
| Clone | 3G1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDC2L5 Antibody (3G1) from Novus Biologicals is a mouse monoclonal antibody to CDC2L5. This antibody reacts with human. The CDC2L5 Antibody (3G1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CDC2L5 (AAH01274, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDK |
|---|
| Other Names | CDC2L5, CDC2LEC 2.7.11.22, CDC2-related protein kinase 5, Cell division cycle 2-like protein kinase 5, Cell division protein kinase 13, CHEDcell division cycle 2-like 5 (cholinesterase-related cell division controller), Cholinesterase-related cell division controller, cyclin-dependent kinase 13, EC 2.7.11, EC 2.7.11.23, hCDK13, KIAA1791FLJ35215 |
|---|
| Gene, Accession # | CDK13, Gene ID: 8621, Accession: AAH01274, SwissProt: AAH01274 |
|---|
| Catalog # | H00008621-M02 |
|---|
| Price | |
|---|
| Order / More Info | CDC2L5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|