| Edit |   |
|---|
| Antigenic Specificity | DOCK2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DOCK2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DOCK2. This antibody reacts with human. The DOCK2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to DOCK2(dedicator of cytokinesis 2) The peptide sequence was selected from the middle region of DOCK2. Peptide sequence ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA. |
|---|
| Other Names | dedicator of cytokinesis 2, dedicator of cytokinesis protein 2, FLJ46592, KIAA0209dedicator of cyto-kinesis 2 |
|---|
| Gene, Accession # | DOCK2, Gene ID: 1794, Accession: Q92608, SwissProt: Q92608 |
|---|
| Catalog # | NBP1-58870 |
|---|
| Price | |
|---|
| Order / More Info | DOCK2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|