| Edit |   |
|---|
| Antigenic Specificity | DOCK4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DOCK4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DOCK4. This antibody reacts with human. The DOCK4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DOCK4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CSAIYPTPVEPSQRMLFNHIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISP |
|---|
| Other Names | dedicator of cytokinesis 4, dedicator of cytokinesis protein 4, KIAA0716FLJ34238, MGC134911, MGC134912 |
|---|
| Gene, Accession # | DOCK4, Gene ID: 9732 |
|---|
| Catalog # | NBP2-57555 |
|---|
| Price | |
|---|
| Order / More Info | DOCK4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|