| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DOCK9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DOCK9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DOCK9. This antibody reacts with human. The DOCK9 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DOCK9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LQLNFEAAMQEKRNGDSHEDDEQSKLEGSGSGLDSYLPELAKSAREAEIKLKSESRVKLFYLDPDAQKLDFSSAEPEV |
|---|
| Other Names | Cdc42 guanine nucleotide exchange factor zizimin-1, dedicator of cytokinesis 9, dedicator of cytokinesis protein 9, DKFZp686C11110, DKFZp686D2047, DKFZp686N04132, FLJ11949, FLJ16744, FLJ45601, KIAA1058FLJ44528, KIAA1085, ZIZ1FLJ45282, ZIZIMIN1 |
|---|
| Gene, Accession # | DOCK9, Gene ID: 23348, Accession: Q9BZ29, SwissProt: Q9BZ29 |
|---|
| Catalog # | NBP2-38517 |
|---|
| Price | |
|---|
| Order / More Info | DOCK9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|