| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDC40 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDC40 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDC40. This antibody reacts with human. The CDC40 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CDC40 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKT |
|---|
| Other Names | Cell division cycle 40 homolog, cell division cycle 40 homolog (S. cerevisiae), cell division cycle 40 homolog (yeast), Ehb3, EH-binding protein 3, hPRP17, MGC102802, pre-mRNA splicing factor 17, pre-mRNA-processing factor 17, PRP17 homolog, PRP17EHB3PRPF17FLJ10564 |
|---|
| Gene, Accession # | CDC40, Gene ID: 51362 |
|---|
| Catalog # | NBP2-58541 |
|---|
| Price | |
|---|
| Order / More Info | CDC40 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|