| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cdc6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cdc6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cdc6. This antibody reacts with human. The Cdc6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Cdc6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPP |
|---|
| Other Names | CDC18LHsCDC18, Cdc18-related protein, CDC6 (cell division cycle 6, S. cerevisiae) homolog, CDC6 cell division cycle 6 homolog, CDC6 cell division cycle 6 homolog (S. cerevisiae), CDC6-related protein, cell division control protein 6 homolog, cell division cycle 6 homolog (S. cerevisiae), cell division cycle 6 protein, HsCdc18, HsCDC6, p62(cdc6) |
|---|
| Gene, Accession # | CDC6, Gene ID: 990 |
|---|
| Catalog # | NBP2-47514 |
|---|
| Price | |
|---|
| Order / More Info | Cdc6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|