| 产品详情 |
| Edit |   |
| Antigenic Specificity | ERP27 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ERP27 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ERP27. This antibody reacts with human. The ERP27 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ERP27 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FQDLEIPAVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFNSVIQ |
| Other Names | C12orf46, chromosome 12 open reading frame 46, endoplasmic reticulum protein 27, endoplasmic reticulum protein 27 kDa, endoplasmic reticulum resident protein 27, ER protein 27, ERp27, FLJ32115, PDIA8, protein disulfide isomerase family A, member 8 |
| Gene, Accession # | ERP27, Gene ID: 121506, Accession: Q96DN0, SwissProt: Q96DN0 |
| Catalog # | NBP2-38679 |
| Price | |
| Order / More Info | ERP27 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|