| 产品详情 |
| Edit |   |
| Antigenic Specificity | ERP29 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ERP29 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ERP29. This antibody reacts with human. The ERP29 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ERP29 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSV |
| Other Names | C12orf8chromosome 12 open reading frame 8, endoplasmic reticulum lumenal protein ERp28, endoplasmic reticulum protein 29, Endoplasmic reticulum resident protein 28, endoplasmic reticulum resident protein 29, ERp28Endoplasmic reticulum resident protein 31, ERp29, ERp31ERP28, PDIA9, PDI-DB, protein disulfide isomerase family A, member 9 |
| Gene, Accession # | ERP29, Gene ID: 10961 |
| Catalog # | NBP1-88395 |
| Price | |
| Order / More Info | ERP29 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|