| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NR6/CLC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NR6/CLC Antibody from Novus Biologicals is a rabbit polyclonal antibody to NR6/CLC. This antibody reacts with human. The NR6/CLC Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NR6/CLC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE |
|---|
| Other Names | B-cell stimulating factor 3, B-cell stimulatory factor 3, BSF3BSF-3, cardiotrophin-like cytokine factor 1, CISS2, CLCNNT-1, CRLF1 associated cytokine-like factor 1, neurotrophin-1/B-cell stimulating factor-3, NNT1B-cell-stimulating factor 3, Novel neurotrophin-1, NR6 |
|---|
| Gene, Accession # | CLCF1, Gene ID: 23529 |
|---|
| Catalog # | NBP1-89926 |
|---|
| Price | |
|---|
| Order / More Info | NR6/CLC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|