| Edit |   |
|---|
| Antigenic Specificity | TMCO4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMCO4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMCO4. This antibody reacts with human. The TMCO4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMCO4 (transmembrane and coiled-coil domains 4) The peptide sequence was selected from the C terminal of TMCO4. Peptide sequence WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS. |
|---|
| Other Names | DKFZp686C23231, RP5-1056L3.6, transmembrane and coiled-coil domain-containing protein 4, transmembrane and coiled-coil domains 4 |
|---|
| Gene, Accession # | TMCO4, Gene ID: 255104, Accession: Q5TGY1, SwissProt: Q5TGY1 |
|---|
| Catalog # | NBP1-68907 |
|---|
| Price | |
|---|
| Order / More Info | TMCO4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|