| Edit |   |
|---|
| Antigenic Specificity | TMCO6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMCO6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMCO6. This antibody reacts with human. The TMCO6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMCO6(transmembrane and coiled-coil domains 6) The peptide sequence was selected from the N terminal of TMCO6. Peptide sequence LRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSN. |
|---|
| Other Names | FLJ39769, PRO1580, transmembrane and coiled-coil domain-containing protein 6, transmembrane and coiled-coil domains 6 |
|---|
| Gene, Accession # | TMCO6, Gene ID: 55374, Accession: Q96DC7, SwissProt: Q96DC7 |
|---|
| Catalog # | NBP1-57660 |
|---|
| Price | |
|---|
| Order / More Info | TMCO6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|