| Edit |   |
|---|
| Antigenic Specificity | TM2D3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TM2D3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TM2D3. This antibody reacts with human. The TM2D3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TM2D3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC |
|---|
| Other Names | BBP-like protein 2, BLP2Beta-amyloid-binding protein-like protein 2, FLJ22604, TM2 domain containing 3, TM2 domain-containing protein 3 |
|---|
| Gene, Accession # | TM2D3, Gene ID: 80213, Accession: Q9BRN9, SwissProt: Q9BRN9 |
|---|
| Catalog # | NBP2-30535 |
|---|
| Price | |
|---|
| Order / More Info | TM2D3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|