| Edit |   |
|---|
| Antigenic Specificity | GRXCR2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GRXCR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRXCR2. This antibody reacts with human. The GRXCR2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GRXCR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KSDGKPRKVRFKISSSYSGRVLKQVFEDGQELESPKEEYPHSFLQESLETMDGVYGSGEVPRPQMCSPKL |
|---|
| Other Names | Glutaredoxin Domain-Containing Cysteine-Rich Protein 1-Like Protein, Glutaredoxin Domain-Containing Cysteine-Rich Protein 2, Glutaredoxin, Cysteine Rich 2, GRXCR1-Like Protein |
|---|
| Gene, Accession # | GRXCR2, Gene ID: 643226 |
|---|
| Catalog # | NBP2-32458 |
|---|
| Price | |
|---|
| Order / More Info | GRXCR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|