| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OBFC2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OBFC2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to OBFC2A. This antibody reacts with human. The OBFC2A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human OBFC2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFK |
|---|
| Other Names | DKFZp667M1322, FLJ13624, FLJ22833, hSSB2, MGC111163, oligonucleotide/oligosaccharide-binding fold containing 2A, Oligonucleotide/oligosaccharide-binding fold-containing protein 2A, Sensor of single-strand DNA complex subunit B2, Sensor of ssDNA subunit B2, SOSS complex subunit B2, SOSS-B2, SSB2Single-stranded DNA-binding protein 2 |
|---|
| Gene, Accession # | NABP1, Gene ID: 64859 |
|---|
| Catalog # | NBP2-58805 |
|---|
| Price | |
|---|
| Order / More Info | OBFC2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|