| Edit |   |
|---|
| Antigenic Specificity | Obox6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Obox6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Obox6. This antibody reacts with mouse. The Obox6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of mouse OBOX6. Peptide sequence MALAVLVGVTANEIQIWFKNHRAKSKRESLQNVPAALPETNGSSEAVSES. |
|---|
| Other Names | oocyte specific homeobox 6 |
|---|
| Gene, Accession # | OBOX6, Gene ID: 252830, Accession: NP_663756 |
|---|
| Catalog # | NBP1-91619-20ul |
|---|
| Price | |
|---|
| Order / More Info | Obox6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|