| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OCA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OCA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OCA2. This antibody reacts with human. The OCA2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to OCA2(oculocutaneous albinism II) The peptide sequence was selected from the middle region of OCA2. Peptide sequence LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC. |
|---|
| Other Names | BEY, BEY1, BEY2, D15S12BOCA, EYCL, EYCL2, eye color 2 (central brown), eye color 3 (brown), hair color 3 (brown), HCL3, Melanocyte-specific transporter protein, oculocutaneous albinism II, oculocutaneous albinism II (pink-eye dilution (murine) homolog), oculocutaneous albinism II (pink-eye dilution homolog, mouse), P protein, PED, PEYCL3, Pink-eyed dilution protein homolog, SHEP1, total brown iris pigmentation |
|---|
| Gene, Accession # | OCA2, Gene ID: 4948, Accession: Q04671, SwissProt: Q04671 |
|---|
| Catalog # | NBP1-60052 |
|---|
| Price | |
|---|
| Order / More Info | OCA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|