| Edit |   |
| Antigenic Specificity | OCAM/NCAM2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 23952781). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The OCAM/NCAM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OCAM/NCAM2. This antibody reacts with human. The OCAM/NCAM2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human OCAM/NCAM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NVPPAISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPY |
| Other Names | N-CAM-2, NCAM-2, NCAM21MGC51008, neural cell adhesion molecule 2, neural cell adhesion molecule 2 precursor10 |
| Gene, Accession # | NCAM2, Gene ID: 4685 |
| Catalog # | NBP1-82669 |
| Price | |
| Order / More Info | OCAM/NCAM2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23952781 |