| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDE2A |
|---|
| Clone | 4F4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDE2A Antibody (4F4) from Novus Biologicals is a mouse monoclonal antibody to PDE2A. This antibody reacts with human. The PDE2A Antibody (4F4) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | PDE2A (NP_002590 850 a.a. - 940 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA |
|---|
| Other Names | cGMP-dependent 3'-5'-cyclic phosphodiesterase, cGMP-stimulated phosphodiesterase 1, cGMP-stimulated phosphodiesterase 4, cGSPDE, CGS-PDE, Cyclic GMP-stimulated phosphodiesterase, EC 3.1.4, EC 3.1.4.17, PDE2A1, PED2A4, phosphodiesterase 2A, cGMP-stimulated |
|---|
| Gene, Accession # | PDE2A, Gene ID: 5138, Accession: NP_002590, SwissProt: NP_002590 |
|---|
| Catalog # | H00005138-M01 |
|---|
| Price | |
|---|
| Order / More Info | PDE2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|