| Edit |   |
| Antigenic Specificity | GABRA3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100ug |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-GABRA3 Antibody |
| Immunogen | The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the N terminal of human GABRA3. Synthetic peptide located within the following region: GTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRL |
| Other Names | gamma-aminobutyric acid (GABA) A receptor,alpha 3 |
| Gene, Accession # | GBRA3, Accession: NM_000808 |
| Catalog # | TA330435 |
| Price | |
| Order / More Info | GABRA3 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |