| Edit |   |
| Antigenic Specificity | C4orf47 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C4orf47 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C4orf47. This antibody reacts with human. The C4orf47 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C4orf47 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSN |
| Other Names | chromosome 4 open reading frame 47 |
| Gene, Accession # | C4orf47, Gene ID: 441054 |
| Catalog # | NBP1-93540 |
| Price | |
| Order / More Info | C4orf47 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |