| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | C5orf51 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P reported in a verified customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C5orf51 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C5orf51. This antibody reacts with human, mouse. The C5orf51 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse C5orf51 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN |
|---|
| Other Names | chromosome 5 open reading frame 51, hypothetical protein LOC285636, LOC285636, UPF0600 protein |
|---|
| Gene, Accession # | C5ORF51, Gene ID: 285636, Accession: A6NDU8, SwissProt: A6NDU8 |
|---|
| Catalog # | NBP2-32025 |
|---|
| Price | |
|---|
| Order / More Info | C5orf51 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|