| Edit |   |
|---|
| Antigenic Specificity | C6orf201 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C6orf201 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C6orf201. This antibody reacts with human. The C6orf201 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C6ORF201 The peptide sequence was selected from the N terminal of C6ORF201. Peptide sequence PFGMGLGNTSRSTDAPSQSTGDRKTGSVGSWGAARGPSGTDTVSGQSNSG. |
|---|
| Other Names | chromosome 6 open reading frame 201, dJ1013A10.5, hypothetical protein LOC404220, MGC87625, protein MGC87625 |
|---|
| Gene, Accession # | C6ORF201, Gene ID: 404220 |
|---|
| Catalog # | NBP1-70476-20ul |
|---|
| Price | |
|---|
| Order / More Info | C6orf201 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|