| 产品详情 |
| Edit |   |
| Antigenic Specificity | PIP5K2B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PIP5K2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIP5K2B. This antibody reacts with human. The PIP5K2B Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PIP5K2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH |
| Other Names | 1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta, Diphosphoinositide kinase 2-beta, EC 2.7.1, EC 2.7.1.149, phosphatidylinositol-4-phosphate 5-kinase, type II, beta, Phosphatidylinositol-5-phosphate 4-kinase type II beta, phosphatidylinositol-5-phosphate 4-kinase type-2 beta, phosphatidylinositol-5-phosphate 4-kinase, type II, beta, PI(5)P 4-kinase type II beta, PI5P4KB, PIP4KII-beta, PIP5K2B, PIP5KIIB, PIP5KIIbeta, PTDINS(4)P-5-kinase, PtdIns(5)P-4-kinase isoform 2-beta |
| Gene, Accession # | PIP4K2B, Gene ID: 8396 |
| Catalog # | NBP2-56946 |
| Price | |
| Order / More Info | PIP5K2B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|