| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIP5K2 gamma |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIP5K2 gamma Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIP5K2 gamma. This antibody reacts with human. The PIP5K2 gamma Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PIP5K2 gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQY |
|---|
| Other Names | EC 2.7.1, EC 2.7.1.149, FLJ22055, phosphatidylinositol-4-phosphate 5-kinase, type II, gamma, Phosphatidylinositol-5-phosphate 4-kinase type II gamma, phosphatidylinositol-5-phosphate 4-kinase type-2 gamma, phosphatidylinositol-5-phosphate 4-kinase, type II, gamma, PI(5)P 4-kinase type II gamma, PIP4KII-gamma, PIP5K2C |
|---|
| Gene, Accession # | PIP4K2C, Gene ID: 79837 |
|---|
| Catalog # | NBP2-56140 |
|---|
| Price | |
|---|
| Order / More Info | PIP5K2 gamma Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|