| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIP5KL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIP5KL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIP5KL1. This antibody reacts with human. The PIP5KL1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PIP5KL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ISERYDIKGCEVSRWVDPAPEGSPLVLVLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHE |
|---|
| Other Names | bA203J24.5, EC 2.7.1.68, MGC46424, phosphatidylinositol phosphate kinase homolog, phosphatidylinositol-4-phosphate 5-kinase-like 1, phosphatidylinositol-4-phosphate 5-kinase-like protein 1, PI(4)P 5-kinase-like protein 1, PIPKH, PtdIns(4)P-5-kinase-like protein 1 |
|---|
| Gene, Accession # | PIP5KL1, Gene ID: 138429, Accession: Q5T9C9, SwissProt: Q5T9C9 |
|---|
| Catalog # | NBP2-33779 |
|---|
| Price | |
|---|
| Order / More Info | PIP5KL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|