| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Pirh2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Pirh2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Pirh2. This antibody reacts with human. The Pirh2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Pirh2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHL |
|---|
| Other Names | Androgen receptor N-terminal-interacting protein, androgen-receptor N-terminal-interacting protein, ARNIPRING finger protein 199, CHIMPRNF199DKFZp586C1620, CH-rich interacting match with PLAG1, CH-rich-interacting match with PLAG1, E3 ubiquitin-protein ligase Pirh2, EC 6.3.2.-, hARNIP, hPirh2, PIRH2, PRO1996, ring finger and CHY zinc finger domain containing 1, RING finger and CHY zinc finger domain-containing protein 1, Zinc finger protein 363p53-induced RING-H2 protein, ZNF363 |
|---|
| Gene, Accession # | RCHY1, Gene ID: 25898 |
|---|
| Catalog # | NBP1-90098 |
|---|
| Price | |
|---|
| Order / More Info | Pirh2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|