| Edit |   |
|---|
| Antigenic Specificity | TMEM176A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM176A Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM176A. This antibody reacts with human. The TMEM176A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM176A(transmembrane protein 176A) The peptide sequence was selected from the middle region of TMEM176A. Peptide sequence GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ. |
|---|
| Other Names | GS188, HCA112Hepatocellular carcinoma-associated antigen 112, likley ortholog of mouse GS188, transmembrane protein 176A |
|---|
| Gene, Accession # | TMEM176A, Gene ID: 55365, Accession: Q96HP8, SwissProt: Q96HP8 |
|---|
| Catalog # | NBP1-60015-20ul |
|---|
| Price | |
|---|
| Order / More Info | TMEM176A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|