| Edit |   |
| Antigenic Specificity | TMEM184A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM184A Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM184A. This antibody reacts with human. The TMEM184A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMEM184A(transmembrane protein 184A) The peptide sequence was selected from the C terminal of TMEM184A. Peptide sequence CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT. |
| Other Names | FLJ24011, transmembrane protein 184A |
| Gene, Accession # | TMEM184A, Gene ID: 202915 |
| Catalog # | NBP1-70728-20ul |
| Price | |
| Order / More Info | TMEM184A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |