| Edit |   |
|---|
| Antigenic Specificity | TMEM30A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM30A Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM30A. This antibody reacts with human. The TMEM30A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM30A(transmembrane protein 30A) The peptide sequence was selected from the N terminal of TMEM30A. Peptide sequence FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC. |
|---|
| Other Names | C6orf67, cell cycle control protein 50A, chromosome 6 open reading frame 67, transmembrane protein 30ACDC50AFLJ10856 |
|---|
| Gene, Accession # | TMEM30A, Gene ID: 55754, Accession: Q9NV96, SwissProt: Q9NV96 |
|---|
| Catalog # | NBP1-59474 |
|---|
| Price | |
|---|
| Order / More Info | TMEM30A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|