| 产品详情 |
| Edit |   |
| Antigenic Specificity | USP38 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The USP38 Antibody from Novus Biologicals is a rabbit polyclonal antibody to USP38. This antibody reacts with human. The USP38 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human USP38 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YSYARNITSTDSSYQMYHQSEALALASSQSHLLGRDSPSAVFEQDLENKE MSKEWFLFNDSRVTFTSFQSVQ |
| Other Names | Deubiquitinating enzyme 38, EC 3.4.19.12, HP43.8KDFLJ35970, KIAA1891ubiquitin specific protease 38, ubiquitin carboxyl-terminal hydrolase 38, ubiquitin specific peptidase 38, ubiquitin thioesterase 38, Ubiquitin thiolesterase 38, Ubiquitin-specific-processing protease 38 |
| Gene, Accession # | USP38, Gene ID: 84640 |
| Catalog # | NBP2-13510 |
| Price | |
| Order / More Info | USP38 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|