| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | USP4 |
|---|
| Clone | 5E12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The USP4 Antibody (5E12) from Novus Biologicals is a mouse monoclonal antibody to USP4. This antibody reacts with human. The USP4 Antibody (5E12) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | USP4 (NP_003354 676 a.a. - 773 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKK |
|---|
| Other Names | Deubiquitinating enzyme 4, EC 3.1.2.15, EC 3.4.19.12, MGC149848, MGC149849, ubiquitin carboxyl-terminal esterase 4, ubiquitin carboxyl-terminal hydrolase 4, ubiquitin specific peptidase 4 (proto-oncogene), ubiquitin specific protease 4 (proto-oncogene), ubiquitin thioesterase 4, Ubiquitin thiolesterase 4, ubiquitin-specific processing protease 4, Ubiquitin-specific-processing protease 4, Ubiquitous nuclear protein homolog, UNPH, UNPUnph |
|---|
| Gene, Accession # | USP4, Gene ID: 7375, Accession: NP_003354, SwissProt: NP_003354 |
|---|
| Catalog # | H00007375-M01 |
|---|
| Price | |
|---|
| Order / More Info | USP4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|