| Edit |   |
|---|
| Antigenic Specificity | Wnt-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Wnt-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Wnt-2. This antibody reacts with human. The Wnt-2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to WNT2(wingless-type MMTV integration site family member 2) The peptide sequence was selected from the middle region of WNT2. Peptide sequence GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR. |
|---|
| Other Names | INT1L1secreted growth factor, Int-1-like protein 1, Int-1-related protein, IRPprotein Wnt-2, wingless-type MMTV integration site family member 2 |
|---|
| Gene, Accession # | WNT2, Gene ID: 7472, Accession: P09544, SwissProt: P09544 |
|---|
| Catalog # | NBP1-57938 |
|---|
| Price | |
|---|
| Order / More Info | Wnt-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|